DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CC and Pp4-19C

DIOPT Version :9

Sequence 1:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:285 Identity:135/285 - (47%)
Similarity:198/285 - (69%) Gaps:9/285 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    30 LQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYV 94
            ::|||::.||.|:|||.:.:..:..:::|:.:|||||||:|||..||:.||..||.||||:||:|
  Fly    20 IKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFV 84

Human    95 DRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNC 158
            |||..|:||..||||.|::||:...|:|||||...|.::|||||||.|:| :..:|:..|:.|:.
  Fly    85 DRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTAVWRYCTEIFDY 149

Human   159 LPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGV 223
            |.::||:|.||||.||||||.:|.::|||.|.|..:||..|.:||||||||: |..|||.:.||.
  Fly   150 LSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DQTGWGVSPRGA 213

Human   224 SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 288
            .:.||::||::|...:|:|:||||||:|.:|:::.....::|::||||||....|..|::.::|.
  Fly   214 GYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEY 278

Human   289 LMCSFQILKPAEK-------KKPNA 306
            |...|.|.:.|.:       |||.|
  Fly   279 LHRDFVIFEAAPQESRGIPSKKPQA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 135/285 (47%)
MPP_PP1_PPKL 8..298 CDD:277359 130/268 (49%)
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 130/270 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.