DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CC and CanA1

DIOPT Version :9

Sequence 1:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens
Sequence 2:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster


Alignment Length:307 Identity:113/307 - (36%)
Similarity:175/307 - (57%) Gaps:29/307 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     6 KLNIDSIIQR-LLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 69
            |.|.|::.|. |||.|         ::|.....:..:...:...:..::::|||:.:|||||||:
  Fly    80 KPNFDALRQHFLLEGR---------IEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQF 135

Human    70 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 134
            :||::|||.||.|..:.|||||||||||..|:|.:..|.:.||.||....||||||||..:...:
  Fly   136 FDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYF 200

Human   135 GFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQG 199
            .|..||..:|:..::....:.|:|||:||:::::..|.||||||::.:::.|:.:.|..:.|..|
  Fly   201 TFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYG 265

Human   200 LLCDLLWSDPDKDVLGWGEND-------RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEF 257
            .:||||||||.:|......|:       ||.|:.|......:||.|::|..|.|||:..:.||..
  Fly   266 PMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRM 330

Human   258 FAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM------CS 292
            :.|.|      |:|:||||||...::|..|::..:..:|      ||
  Fly   331 YRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 113/307 (37%)
MPP_PP1_PPKL 8..298 CDD:277359 112/305 (37%)
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 112/306 (37%)
PP2Ac 98..369 CDD:197547 102/270 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.