DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CC and PpN58A

DIOPT Version :9

Sequence 1:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:299 Identity:187/299 - (62%)
Similarity:242/299 - (80%) Gaps:4/299 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71
            :|:|.||.:|..:  .:.|..||:...||..:|.::||:.|.||.|||:.||:.:.|||||||.:
  Fly    22 INLDQIIAKLKLI--GEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLN 84

Human    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136
            |||.||..|:||:|.||.|||||||||||:||:.||||.|.:||..|:||||||||:|||..|||
  Fly    85 LLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGF 149

Human   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201
            ||||||||.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.|.||.::|:.||:
  Fly   150 YDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLI 214

Human   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266
            ||:||||||..::|||.|:||||.|||::||:.|||:..|:||||.||||||||||||||||:|:
  Fly   215 CDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITI 279

Human   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKP--AEKKK 303
            |||||||||||||||||.:::.|:|:|::.:|  :|:::
  Fly   280 FSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQRR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 187/299 (63%)
MPP_PP1_PPKL 8..298 CDD:277359 185/289 (64%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 185/290 (64%)
MPP_superfamily 23..311 CDD:301300 185/289 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.