DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CC and Pp1-Y2

DIOPT Version :9

Sequence 1:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens
Sequence 2:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster


Alignment Length:305 Identity:227/305 - (74%)
Similarity:265/305 - (86%) Gaps:6/305 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MADLDKL-NIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGD 64
            |..|.:| |||.:|.|:::.|..   |.:.|.|.:||.||.:|||:|:|||:||||.||:|||||
  Fly     5 MTTLTELNNIDQLILRIIDTRRL---KQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGD 66

Human    65 IHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECAS 129
            ||||:.||||||:|||:||.||||||||||||||||:||:||||||||||||||||||||||.|.
  Fly    67 IHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAG 131

Human   130 INRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTD 194
            |||||||||||||||.||||:||.||::|:|::||||||||||||||||||.:|.||.::.||.|
  Fly   132 INRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCD 196

Human   195 VPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA 259
            |||:||||||||||||..::||.:||||||.||||::|.||:|:|..||||||||||||||||||
  Fly   197 VPDKGLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFA 261

Human   260 KRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKP 304
            ||||:|:|||||||||||||||||||||||||||.:|||:  |||
  Fly   262 KRQLITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKPS--KKP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 225/300 (75%)
MPP_PP1_PPKL 8..298 CDD:277359 219/289 (76%)
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 222/297 (75%)
MPP_PP1_PPKL 13..300 CDD:277359 219/289 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.