DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CC and PpV

DIOPT Version :9

Sequence 1:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens
Sequence 2:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster


Alignment Length:324 Identity:136/324 - (41%)
Similarity:195/324 - (60%) Gaps:34/324 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI 65
            |.|:||.        :.:|:..|     .|.|||::.||....:|.|.:..:|.:..|:.:||||
  Fly     1 MGDVDKW--------IEDVKKCK-----YLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDI 52

Human    66 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 130
            |||:|||.:||..||..|.:||:|:||:||||..||||...||..|.:||....|||||||...|
  Fly    53 HGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQI 117

Human   131 NRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTD 194
            .::|||:|||..:| |...||.....|:.|.||||:||::.|.||||||::.:::|||.|.|..:
  Fly   118 TKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGE 182

Human   195 VPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA 259
            :|.:|..|||:||||: |:..||::.||..:.||..|...|:..::|:|||||||:|.:|.::..
  Fly   183 IPYKGAFCDLVWSDPE-DMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMF 246

Human   260 KRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK-------PNATRPVTPPRAT 316
            ..:|||::||||||....|..|::|           .:.|||::       |:|.| |.|.:.|
  Fly   247 DGKLVTVWSAPNYCYRCGNVAAILS-----------FETAEKRQTKIFLAVPDAER-VIPKQNT 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 132/316 (42%)
MPP_PP1_PPKL 8..298 CDD:277359 123/290 (42%)
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 135/322 (42%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 129/308 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.