DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CA and Pp1-13C

DIOPT Version :9

Sequence 1:NP_001008709.1 Gene:PPP1CA / 5499 HGNCID:9281 Length:341 Species:Homo sapiens
Sequence 2:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster


Alignment Length:311 Identity:275/311 - (88%)
Similarity:285/311 - (91%) Gaps:11/311 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     4 SEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEA 68
            :|.|||:|||.||||           |:|:||||||||:|.||||||||||||.|:|||||||||
  Fly     2 AEVLNLESIISRLLE-----------VRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEA 55

Human    69 PLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 133
            |||||||||||||||||||||||:|||:|||||||||||||||||||||||||||||.|||||||
  Fly    56 PLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR 120

Human   134 GNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIR 198
            ||||||||||||||||||||||.|||||||||||||||:.||||||||||||||||||.||||||
  Fly   121 GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIR 185

Human   199 RIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVE 263
            |||||||||||||||||||||||||..||||||||||||||||||.|||.|||||||||||||||
  Fly   186 RIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVE 250

Human   264 DGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNK 314
            ||||||||||||||||||||||||||||||||||.|||||||||||.:|.|
  Fly   251 DGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CANP_001008709.1 PTZ00480 6..319 CDD:185658 274/309 (89%)
MPP_PP1_PPKL 8..309 CDD:277359 269/300 (90%)
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 272/304 (89%)
MPP_PP1_PPKL 6..296 CDD:277359 269/300 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147227
Domainoid 1 1.000 395 1.000 Domainoid score I761
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.