DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mapk1 and rl

DIOPT Version :9

Sequence 1:NP_001017127.1 Gene:mapk1 / 549881 XenbaseID:XB-GENE-479467 Length:361 Species:Xenopus tropicalis
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:354 Identity:286/354 - (80%)
Similarity:309/354 - (87%) Gaps:0/354 - (0%)


- Green bases have known domain annotations that are detailed below.


 Frog     5 GASSNPGGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQ 69
            |::..|....|::|||.|:|||||..|:||||||||||.||.|.:...|||||||||||||||||
  Fly    15 GSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQ 79

 Frog    70 RTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLY 134
            ||||||.||.||||||||.|.||:|..:|:||:||||||.|||||||||||||.|||||||||||
  Fly    80 RTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLY 144

 Frog   135 QILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAP 199
            |||||||||||||||||||||||||||.|||||||||||||:|||:|||||||||||||||||||
  Fly   145 QILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAP 209

 Frog   200 EIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKAR 264
            ||||||||||||||||||||||||||||||||||||||||||||||:|||||::||.||||.|||
  Fly   210 EIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKAR 274

 Frog   265 NYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAE 329
            |||.|||.|..|||.:||||||..|||||.|||||||||||.||.|||||||||||||.||||||
  Fly   275 NYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAE 339

 Frog   330 APFKFEMELDDLPKETLKELIFEETARFQ 358
            .||:..||.||:.::.||.||||||.:|:
  Fly   340 VPFRINMENDDISRDALKSLIFEETLKFK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mapk1NP_001017127.1 STKc_ERK1_2_like 22..356 CDD:270839 279/333 (84%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 279/333 (84%)
S_TKc 38..326 CDD:214567 246/287 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 507 1.000 Domainoid score I330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37670
Inparanoid 1 1.050 592 1.000 Inparanoid score I965
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - oto104638
Panther 1 1.100 - - LDO PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1382
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.