DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NMRK1 and arm

DIOPT Version :10

Sequence 1:NP_001317607.1 Gene:NMRK1 / 54981 HGNCID:26057 Length:203 Species:Homo sapiens
Sequence 2:NP_476665.2 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster


Alignment Length:99 Identity:23/99 - (23%)
Similarity:35/99 - (35%) Gaps:44/99 - (44%)


- Green bases have known domain annotations that are detailed below.


Human   138 YQPPDSPGYFDGHVWPMYLKYRQEMQDITW-----------------EVVYLDGTKSEE------ 179
            |.|||.|        ||   ...:.|.:.|                 :|..|.|.:.||      
  Fly    17 YNPPDLP--------PM---VSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPL 70

Human   180 --DL---FLQVY-----EDLIQELAKQKCLQVTA 203
              ||   |.|.:     :|:.|:|::.:..:|.|
  Fly    71 MFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NMRK1NP_001317607.1 NRK1 12..164 CDD:238982 7/25 (28%)
armNP_476665.2 CTNNAbd_dArm 85..159 CDD:439243 5/20 (25%)
Adaptin_N <150..>314 CDD:396262
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:425727
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:425727
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:425727
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.