DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CT55 and C41D11.6

DIOPT Version :9

Sequence 1:NP_001026875.1 Gene:CT55 / 54967 HGNCID:26047 Length:264 Species:Homo sapiens
Sequence 2:NP_491376.1 Gene:C41D11.6 / 183377 WormBaseID:WBGene00016565 Length:852 Species:Caenorhabditis elegans


Alignment Length:136 Identity:31/136 - (22%)
Similarity:55/136 - (40%) Gaps:25/136 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   130 NSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPI-RCIHTEEVCITSVHGRNGVID 193
            |...|||...:..|||...|  ....||: .|:.|:...::|. ..:|...|      |.:.|: 
 Worm   504 NGTKFSIETPAGTFVPAAVD--HAVQSTD-AITTIECRILRPADNAVHILAV------GEDAVL- 558

Human   194 YTIFFTLDSVKLPDGYVPQVDDIVNV-VMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRPKR 257
                  :...|..||::.....:|.| .:::..:....:.|::..|:..|:       ||..|.:
 Worm   559 ------IKQTKEADGHLLAATPVVPVDTVLDRNKGLATFAALNGGPIIASN-------GLNYPHK 610

Human   258 ERRSQS 263
            |.|.|:
 Worm   611 EFRYQN 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CT55NP_001026875.1 S1-like 41..>78 CDD:316926
S1-like 182..233 CDD:316926 7/51 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..264 7/22 (32%)
C41D11.6NP_491376.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161449010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.