DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPM1B and Ppm1

DIOPT Version :9

Sequence 1:XP_016859884.1 Gene:PPM1B / 5495 HGNCID:9276 Length:487 Species:Homo sapiens
Sequence 2:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster


Alignment Length:317 Identity:132/317 - (41%)
Similarity:189/317 - (59%) Gaps:29/317 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGS 65
            ||..|.:|.|.|..|..|....|.|.|.||||||:||||||.::.:|...:. :||||||||.|:
  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQA-AFFAVYDGHGGA 64

Human    66 RVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNG-MDR 129
            .||.|...||.:.||...::|     .:::|::       ::..||..|..|     |:|| :|.
  Fly    65 SVAKYAGKHLHKFITKRPEYR-----DNSIEVA-------LKKAFLDFDREM-----LQNGSLDE 112

Human   130 --SGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRV 192
              :|.||:.|:|..:.:|..|.|||||:...:|.|...:.||||.:.:|.:||..:||.|...||
  Fly   113 QTAGCTAIVVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRV 177

Human   193 NGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEED-EFIILACDGIWDVMSNEELCE 256
            ||:||:||||||:.||....|.|.||:|:..|:| |:|...|| ||::||||||||||||.|:|:
  Fly   178 NGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDV-EVLDITEDLEFVLLACDGIWDVMSNFEVCQ 241

Human   257 YVKSRLEVSDDLENVCNWVVDTCL----HKGS--RDNMSIVLVCFSNAPKVSDEAVK 307
            :|..|:....:.|.:|..::::||    |.|:  .|||:::|||..:.....|.||:
  Fly   242 FVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVCLLHNKSYEDLAVR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPM1BXP_016859884.1 None
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 120/282 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.