DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPM1B and CG10376

DIOPT Version :9

Sequence 1:XP_016859884.1 Gene:PPM1B / 5495 HGNCID:9276 Length:487 Species:Homo sapiens
Sequence 2:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster


Alignment Length:288 Identity:81/288 - (28%)
Similarity:133/288 - (46%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    35 EMEDAHT--AVVGIPHGLED------------------WSFFAVYDGHAGSRVANYCSTH----L 75
            :.|..||  ||...|..:||                  ..||.|:|||:||..|.|.::.    |
  Fly   155 QKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219

Human    76 LEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS 140
            .:.:..|.|..|         .|.:..:|...:.||..||   .|:..:   ..||:|:|..:|:
  Fly   220 ADQLKANPDPAA---------FSPDFYRNAFESAFLLADE---RFTQKK---ITSGTTSVCALIT 269

Human   141 PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQ----RVNGSLAVSRA 201
            ...:|....|||:|:|..........:.|||.||.|::||:.|||:|:..    ||||.|.|:|:
  Fly   270 KDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARS 334

Human   202 LGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRL-EVS 265
            :|||..          :.|..||:..::...|..:|::|..||:||.:....:.|.|...| :.:
  Fly   335 IGDYSL----------EAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTT 389

Human   266 DDLENVCNWVVDTCLHKGSRDNMSIVLV 293
            ..|:::...:::....:.|:||::.|:|
  Fly   390 MKLDDIPKLLIEAAKERDSQDNITAVVV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPM1BXP_016859884.1 None
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 80/283 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.