DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPM1B and Pdp

DIOPT Version :9

Sequence 1:XP_016859884.1 Gene:PPM1B / 5495 HGNCID:9276 Length:487 Species:Homo sapiens
Sequence 2:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster


Alignment Length:291 Identity:64/291 - (21%)
Similarity:103/291 - (35%) Gaps:87/291 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    58 VYDGHAGSRVANYCSTHLLEHITT---------------------------NEDFRAAGKS---- 91
            ::|||||:......|..||.:::.                           |.||.:..|.    
  Fly    91 IFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEA 155

Human    92 ------GSALELSVENVKNGIRTGFLKIDEYMR----NFSDLRN-GMDRSGSTAVGVMISPKHIY 145
                  ...||....:|.:.:...||::||.:.    ..:|:|. .:..||:.|..|.|....::
  Fly   156 SFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGLQMH 220

Human   146 FINCGDSRAVLYRNGQVCFSTQ---------DHKPCN-----------PREKERIQNAGGSVMIQ 190
            ..:.||..|||   |.:...||         :|...|           |:|:.......|.::.|
  Fly   221 VASTGDCGAVL---GVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQ 282

Human   191 RVNGSLAVSRALGDYDYKC--------------VDGKGP---TEQLVSPEPEVYEILRAEEDEFI 238
                 ||..||.||:.||.              |....|   |...::..|:|.:......|:|:
  Fly   283 -----LAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFL 342

Human   239 ILACDGIWDVMSNEELCEYVKSRLEVSDDLE 269
            ::|.||:||.:...|:...|...:.....||
  Fly   343 VIASDGLWDFLPPSEVVSLVGEHINSKKILE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPM1BXP_016859884.1 None
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 64/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.