DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOHLH2 and mntb

DIOPT Version :9

Sequence 1:NP_060296.2 Gene:SOHLH2 / 54937 HGNCID:26026 Length:425 Species:Homo sapiens
Sequence 2:XP_005170328.1 Gene:mntb / 556663 ZFINID:ZDB-GENE-070820-8 Length:572 Species:Danio rerio


Alignment Length:234 Identity:55/234 - (23%)
Similarity:88/234 - (37%) Gaps:56/234 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   205 LHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAASVLEATVDYVKYI---------------RE 254
            :|:..||.||..:|.|.|.|:..:|.|..:|....|||.:.:.|::.:               ||
Zfish   253 VHNKLEKNRRAHLKECFETLKRNVPNVDEKKTSNLSVLRSALRYIQTLKRKEKEYEHEMERLARE 317

Human   255 KISPAVMAQITEALQSNMRFCKKQQTPIELSLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNGC 319
            ||  |...::.| |::.:..|      |::.....::.|       |..||.. |..|:|...|.
Zfish   318 KI--ATQQRLAE-LKNELSQC------IDIIEINRILRQ-------TVQPEDD-QASTSTASEGE 365

Human   320 STPDAESSLDEAVRVPSSSASENAIGDPYKTHISSAALSLNSLHTVRYYSKVTPSYDATAVTNQN 384
            .....:...|.....|.|:|.:..:..|.:..   ||:.             .||...|.::.|:
Zfish   366 DNFSQDPEDDMLSSPPPSAAPKPPVPLPAEPR---AAMP-------------PPSILPTHISIQH 414

Human   385 ISIHLPSAMPPVSKLLPR--------HCTSGLGQTCTTH 415
            ..:..|||.|..:.|.|:        |..|....|..||
Zfish   415 KPVPPPSAPPQPAVLTPQAIAPAPPSHVVSPPQPTVITH 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOHLH2NP_060296.2 HLH 197..257 CDD:238036 19/66 (29%)
mntbXP_005170328.1 HLH 251..301 CDD:278439 16/47 (34%)
bZIP 292..333 CDD:269834 8/43 (19%)
coiled coil 292..333 CDD:269834 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.