powered by:
Protein Alignment SOHLH2 and mycla
DIOPT Version :9
Sequence 1: | NP_060296.2 |
Gene: | SOHLH2 / 54937 |
HGNCID: | 26026 |
Length: | 425 |
Species: | Homo sapiens |
Sequence 2: | NP_998102.1 |
Gene: | mycla / 405873 |
ZFINID: | ZDB-GENE-040426-2439 |
Length: | 372 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 31/71 - (43%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Human 210 EKLRRERIKYCCEQLRTLLPYVKG-RKNDAASVLEATVDYVKYIREKISPAVMAQITEALQSNMR 273
|:.||:.::...:.||..:|.:.| .|....::|....||:..:.. :|..:|.:....
Zfish 298 ERKRRDDLRSRFQALREEIPGLSGSSKTSKVAILTQATDYLLQLHS-------SQRRQAQEKRKL 355
Human 274 FCKKQQ 279
..|:||
Zfish 356 KAKQQQ 361
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
NCBI |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.