Sequence 1: | NP_060296.2 | Gene: | SOHLH2 / 54937 | HGNCID: | 26026 | Length: | 425 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285976.1 | Gene: | crp / 34956 | FlyBaseID: | FBgn0001994 | Length: | 631 | Species: | Drosophila melanogaster |
Alignment Length: | 372 | Identity: | 59/372 - (15%) |
---|---|---|---|
Similarity: | 106/372 - (28%) | Gaps: | 163/372 - (43%) |
- Green bases have known domain annotations that are detailed below.
Human 178 SESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAASVL 242
Human 243 EATVDYVKYIREK---------------------------------------------------- 255
Human 256 -----------------------ISPAVMAQIT-------------------------------- 265
Human 266 ---EALQSNMRFCKKQQTPIELSLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNG--------- 318
Human 319 ----------------CST-----PDA------ESSLDEAVRVPSSSASE-------NAIGDPYK 349
Human 350 THISSAALSLNSLHTVRYYSKVTPSYDATAVTNQNISI-----HLPS 391 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SOHLH2 | NP_060296.2 | HLH | 197..257 | CDD:238036 | 17/134 (13%) |
crp | NP_001285976.1 | HLH | 97..148 | CDD:278439 | 15/51 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |