DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOHLH2 and crp

DIOPT Version :9

Sequence 1:NP_060296.2 Gene:SOHLH2 / 54937 HGNCID:26026 Length:425 Species:Homo sapiens
Sequence 2:NP_001285976.1 Gene:crp / 34956 FlyBaseID:FBgn0001994 Length:631 Species:Drosophila melanogaster


Alignment Length:372 Identity:59/372 - (15%)
Similarity:106/372 - (28%) Gaps:163/372 - (43%)


- Green bases have known domain annotations that are detailed below.


Human   178 SESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAASVL 242
            |.:|.:|:|  ....|.:.||..:..:.:|: |:.|.:.|....:.||:|||..:|.|...|::|
  Fly    76 SGALSDGDG--SGKPLVDSEKRMRREIANSN-ERRRMQSINAGFQSLRSLLPRHEGEKLSKAAIL 137

Human   243 EATVDYVKYIREK---------------------------------------------------- 255
            :.|..|:..:..:                                                    
  Fly   138 QQTFQYIVELENQKTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNASGGNSTAVAIKK 202

Human   256 -----------------------ISPAVMAQIT-------------------------------- 265
                                   :||..|..:|                                
  Fly   203 RKLTDNVINIQAISDSSDEGLGSMSPEPMTLLTAGGAAATKLSNAATLLAAKELHESKKQLEKER 267

Human   266 ---EALQSNMRFCKKQQTPIELSLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNG--------- 318
               ..|:..::..|:|...:..:.|||.:|.........|.|...::...|...:.         
  Fly   268 SLRRLLEDELQMIKRQLYSVATAPPGTAVAAASGGSSGAYIPREVIEHTDNFVRSEDLEELGGTV 332

Human   319 ----------------CST-----PDA------ESSLDEAVRVPSSSASE-------NAIGDPYK 349
                            ||:     .||      |..:.|.|.:.|:|::|       |||...|.
  Fly   333 SYVEIDEMTGQQQVVVCSSIEELEADAAAEIITEDQVHEEVILSSNSSTESENEVNVNAIAKAYA 397

Human   350 THISSAALSLNSLHTVRYYSKVTPSYDATAVTNQNISI-----HLPS 391
            ...:|:|..|..:  ::...|.||..:...:..:.:.:     .|||
  Fly   398 EGCTSSAAMLQPI--LQAAIKATPKVEVERIHEKIVKVKTEKHDLPS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOHLH2NP_060296.2 HLH 197..257 CDD:238036 17/134 (13%)
crpNP_001285976.1 HLH 97..148 CDD:278439 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.