DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOHLH2 and myca

DIOPT Version :9

Sequence 1:NP_060296.2 Gene:SOHLH2 / 54937 HGNCID:26026 Length:425 Species:Homo sapiens
Sequence 2:NP_571487.2 Gene:myca / 30686 ZFINID:ZDB-GENE-990415-162 Length:419 Species:Danio rerio


Alignment Length:198 Identity:43/198 - (21%)
Similarity:67/198 - (33%) Gaps:69/198 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    79 EELEAIKLIRFGKKKNTH----SLFVFIIPENFKGC-ISGHGMDIALTEPLTME----------K 128
            ||.|.|.::...|::..|    |...:..|...|.| :|.|..:.| ..|.|..          :
Zfish   239 EEEEEIDVVTVEKRQKRHETDASESRYPSPLVLKRCHVSTHQHNYA-AHPSTRHDQPAVKRLRLE 302

Human   129 MSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLE----- 188
            .||.....::..:..||......|       :.|.||.           ::..|..|.||     
Zfish   303 ASNNHSINSSSSNRHVKQRKCASP-------RTSDSED-----------NDKRRTHNVLERQRRN 349

Human   189 --------LNASLSEFEKNKKIS----------LLHSS----------KEKLRR--ERIKYCCEQ 223
                    |...:.|...|:|.:          .:||.          ||:|||  |::|:..:|
Zfish   350 ELKLSFFALRDEIPEVANNEKAAKVVILKKATECIHSMQLDEQRLLSIKEQLRRKSEQLKHRLQQ 414

Human   224 LRT 226
            ||:
Zfish   415 LRS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOHLH2NP_060296.2 HLH 197..257 CDD:238036 14/52 (27%)
mycaNP_571487.2 Myc_N 17..326 CDD:279405 19/87 (22%)
HLH 333..392 CDD:238036 10/69 (14%)
Myc-LZ 390..418 CDD:280500 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.