DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2R2 and vih

DIOPT Version :9

Sequence 1:NP_060281.2 Gene:UBE2R2 / 54926 HGNCID:19907 Length:238 Species:Homo sapiens
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:156 Identity:56/156 - (35%)
Similarity:81/156 - (51%) Gaps:24/156 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    11 KALMLELKSL---QEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSP 72
            |.|..||.:|   .|..:..|    .|..:::.|...|.||.||:|.|..::..:.||..|||:.
  Fly    35 KRLHKELMNLMMANERGISAF----PDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAA 95

Human    73 PTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTF 137
            |..:|||..:|||:...|.:|:.||             .::|:...:|||||||:.|||.|||..
  Fly    96 PVVKFLTSCFHPNVDLQGAICLDIL-------------KDKWSALYDVRTILLSIQSLLGEPNNE 147

Human   138 SPANVDASVMFRKWRDSKGKDKEYAE 163
            ||.|..|::|   |.|.| :.|:|.:
  Fly   148 SPLNAQAAMM---WNDQK-EYKKYLD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2R2NP_060281.2 UBCc 11..169 CDD:238117 56/156 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..238
vihNP_648582.1 COG5078 31..166 CDD:227410 54/151 (36%)
UQ_con 36..172 CDD:278603 55/155 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.