DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2R2 and Ubc7

DIOPT Version :10

Sequence 1:NP_060281.2 Gene:UBE2R2 / 54926 HGNCID:19907 Length:238 Species:Homo sapiens
Sequence 2:NP_524684.2 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:165 Identity:80/165 - (48%)
Similarity:103/165 - (62%) Gaps:6/165 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     8 SSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSP 72
            |:.:.||.|.|.|..:|.||.....:.|.:.:.||..|.||..|.:|||.|.|.:.||.|||.||
  Fly     4 SALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSP 68

Human    73 PTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTF 137
            |..:|...|:||||:.:|.|||||||.|.|||...||.:|||:|.|:|..|||||:|:|.|||..
  Fly    69 PKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPNDE 133

Human   138 SPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSAT 172
            |.|||||::|:|:.||      |:..|.|:.|..|
  Fly   134 SGANVDAAIMWREQRD------EFNAIARRLVRKT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2R2NP_060281.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..238
UBCc_UBE2R 11..180 CDD:467423 79/162 (49%)
Important for ubiquitin transfer. /evidence=ECO:0000269|PubMed:38326650 98..113 7/14 (50%)
Ubc7NP_524684.2 UBCc_UBE2G2 6..163 CDD:467416 79/163 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.