DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2R2 and Ubc6

DIOPT Version :9

Sequence 1:NP_060281.2 Gene:UBE2R2 / 54926 HGNCID:19907 Length:238 Species:Homo sapiens
Sequence 2:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:165 Identity:62/165 - (37%)
Similarity:94/165 - (56%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     7 TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYS 71
            |.:::.||.:.|.|||:|..|......| :::..|...||||.:|.:|.|.||..|:|..:||..
  Fly     3 TPARRRLMRDFKRLQEDPPTGVSGAPTD-NNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNK 66

Human    72 PPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNT 136
            |||.||::|::|||:|.:|.:|:.||             ..||:||.:|..||.|:.|||::||.
  Fly    67 PPTVRFVSKVFHPNVYADGGICLDIL-------------QNRWSPTYDVSAILTSIQSLLSDPNP 118

Human   137 FSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSA 171
            .||||..|:.::::.|      :||    .|:|.|
  Fly   119 NSPANSTAAQLYKENR------REY----EKRVKA 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2R2NP_060281.2 UBCc 11..169 CDD:238117 59/157 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..238
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 61/160 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.