DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2R2 and CG7656

DIOPT Version :9

Sequence 1:NP_060281.2 Gene:UBE2R2 / 54926 HGNCID:19907 Length:238 Species:Homo sapiens
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:239 Identity:159/239 - (66%)
Similarity:197/239 - (82%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     7 TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYS 71
            :|:.:||.:|.||||||||||||:.|:::.:|:.|||||||||:|||:|||||||:|||.|||||
  Fly    39 SSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYS 103

Human    72 PPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNT 136
            ||:.|||||:||||:|||||:||||||||||||||||||.|||||||||||||||||||||||||
  Fly   104 PPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNT 168

Human   137 FSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIK-TKVPSND 200
            |||||||||||:|:||||:|||.||..|||||..|..|||:::|:.||.||.:||:| |:.|:.:
  Fly   169 FSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKPTRKPTTE 233

Human   201 NSSDL-LYDDLY----------DDDIDDEDEEEEDADCYDDDDS 233
            :..|. .|||.:          |||.|::|:::||.|  :|:||
  Fly   234 SGLDANFYDDDFDLETEDDLPSDDDFDEDDDDDEDED--EDEDS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2R2NP_060281.2 UBCc 11..169 CDD:238117 128/157 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..238 17/51 (33%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 117/143 (82%)
COG5078 45..182 CDD:227410 113/136 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 260 1.000 Domainoid score I1980
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3210
Inparanoid 1 1.050 339 1.000 Inparanoid score I2376
Isobase 1 0.950 - 0 Normalized mean entropy S539
OMA 1 1.010 - - QHG52149
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003335
OrthoInspector 1 1.000 - - otm41850
orthoMCL 1 0.900 - - OOG6_104162
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4188
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.