DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2R2 and CG17030

DIOPT Version :9

Sequence 1:NP_060281.2 Gene:UBE2R2 / 54926 HGNCID:19907 Length:238 Species:Homo sapiens
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:178 Identity:51/178 - (28%)
Similarity:84/178 - (47%) Gaps:39/178 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    12 ALMLELK-SLQEEPVEGFRITLVDESDLYNWEVAIF--GPPNTLYEGGYFKAHIKFPIDYPYSPP 73
            |||||.| :||      ||..||:.:::|.|...:.  .||   |:.|.:|..|.||:|||:.||
  Fly    20 ALMLEDKQNLQ------FRNLLVEPNNIYKWTGLLMPVAPP---YDKGAYKMEIDFPLDYPFKPP 75

Human    74 TFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFS 138
            .....|:|:|.|:.|.|.||:.||.            .|.|.||..:..:|..:::.:|:|...:
  Fly    76 RIHINTRMYHLNVNERGQVCVPILE------------VEHWIPTTRIDQVLQVLLATINDPQPEN 128

Human   139 PANVD---------------ASVMFRKWRDSKGKDKEYAEIIRKQVSA 171
            ..:::               |....:|:.:.:..::|.|:..||:..|
  Fly   129 AWHIEMAGEYRNDPVRFFKMADAWVQKYSEPRPTEEELAKFARKRKKA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2R2NP_060281.2 UBCc 11..169 CDD:238117 50/174 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..238
CG17030NP_647941.1 COG5078 12..158 CDD:227410 46/158 (29%)
UQ_con 14..153 CDD:278603 45/153 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.