DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RASIP1 and C52A11.3

DIOPT Version :9

Sequence 1:NP_060275.2 Gene:RASIP1 / 54922 HGNCID:24716 Length:963 Species:Homo sapiens
Sequence 2:NP_496315.2 Gene:C52A11.3 / 183712 WormBaseID:WBGene00008257 Length:131 Species:Caenorhabditis elegans


Alignment Length:59 Identity:17/59 - (28%)
Similarity:20/59 - (33%) Gaps:24/59 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   205 CDAL--------GRPAAAGVG------------SGEWRAEHL----RVLGDSERPLLVQ 239
            ||.|        .|....|||            .|...||.|    |:|..:.||:|.|
 Worm    47 CDTLLVKLQKDANRKIGMGVGVRDRGILITTVVPGSVAAEKLKVGDRILAVNGRPILDQ 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RASIP1NP_060275.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..118
RA 144..258 CDD:279168 17/59 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..356
Myo5p-like_CBD_Rasip1 551..913 CDD:271256
C52A11.3NP_496315.2 PDZ_signaling 51..124 CDD:238492 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D213862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.