powered by:
Protein Alignment RASIP1 and C52A11.3
DIOPT Version :9
Sequence 1: | NP_060275.2 |
Gene: | RASIP1 / 54922 |
HGNCID: | 24716 |
Length: | 963 |
Species: | Homo sapiens |
Sequence 2: | NP_496315.2 |
Gene: | C52A11.3 / 183712 |
WormBaseID: | WBGene00008257 |
Length: | 131 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 17/59 - (28%) |
Similarity: | 20/59 - (33%) |
Gaps: | 24/59 - (40%) |
- Green bases have known domain annotations that are detailed below.
Human 205 CDAL--------GRPAAAGVG------------SGEWRAEHL----RVLGDSERPLLVQ 239
||.| .|....||| .|...||.| |:|..:.||:|.|
Worm 47 CDTLLVKLQKDANRKIGMGVGVRDRGILITTVVPGSVAAEKLKVGDRILAVNGRPILDQ 105
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D213862at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.