DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment figla and Fer1

DIOPT Version :9

Sequence 1:NP_001016342.1 Gene:figla / 549096 XenbaseID:XB-GENE-966403 Length:203 Species:Xenopus tropicalis
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:147 Identity:41/147 - (27%)
Similarity:65/147 - (44%) Gaps:46/147 - (31%)


- Green bases have known domain annotations that are detailed below.


 Frog    31 PYMASINKMKRLPSGHYFCMENFEEVLERRQAANAKERERIRNINSGFSKLKTIVPLIPKDRKPS 95
            |:....:|.:||...        .::.::|||||.:||.|:::||..|..|:|.:|.:|.:::.|
  Fly    67 PFSRRSHKPRRLKCA--------SQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLS 123

 Frog    96 KVDTLKAATEYIRLLHDIL----------------------------EETGG-------FEKVED 125
            ||||||.|..||..|.:::                            :.|||       :.|.:.
  Fly   124 KVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDR 188

 Frog   126 LPDIELTDRYAGTLIPE 142
            .|..:|   ||.|..||
  Fly   189 YPGSKL---YARTWTPE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
figlaNP_001016342.1 HLH 58..115 CDD:238036 26/84 (31%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.