DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL2 and CG31523

DIOPT Version :9

Sequence 1:XP_011513018.1 Gene:ELOVL2 / 54898 HGNCID:14416 Length:326 Species:Homo sapiens
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:287 Identity:108/287 - (37%)
Similarity:159/287 - (55%) Gaps:27/287 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    44 FLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMY-LLSIWLGNKYMKNRPALSLRGILTLYNLGITL 107
            :.|.|....|.||..:|:|.|.|||..:.:.| ..|..||.:.|..|..:.||.:|.:||...|:
  Fly    12 YRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTI 76

Human   108 LSAYMLAELILSTWEGGYNLQCQ--DLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTS 170
            .||::..|.::|.|.|.|:|:||  |.::.|.| :|:..:.||||.||..||.||:||:||||..
  Fly    77 FSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLA-MRMVNICWWYYISKFTEFFDTLFFILRKKNE 140

Human   171 QITFLHVYHHASM-FNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHKYLWWKK 233
            .::.|||.||..| |:: |..|.:.|.|.|.|...||||:||:||.||.::.. |...||:||||
  Fly   141 HVSTLHVIHHGCMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKK 204

Human   234 YLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTY------RKKPM 292
            |||..|:||||...||....:.:.|.:|.|.:::...:.:..:.||.:||...|      |::.:
  Fly   205 YLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAV 269

Human   293 KKDMQEPPAGKEVKNGFSKAYFTAANG 319
            |            .||::..  :|:||
  Fly   270 K------------ANGYANG--SASNG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL2XP_011513018.1 ELO 60..294 CDD:279492 97/244 (40%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 96/238 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.