DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fos and kay

DIOPT Version :9

Sequence 1:NP_001016200.1 Gene:fos / 548954 XenbaseID:XB-GENE-866811 Length:368 Species:Xenopus tropicalis
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:394 Identity:103/394 - (26%)
Similarity:159/394 - (40%) Gaps:88/394 - (22%)


- Green bases have known domain annotations that are detailed below.


 Frog     3 HAFSSSTEYDAASSRCSSASPAGDSLTYYPSPAASFSSMGSPVSPQDFGGDSSSSFVPTVTAIST 67
            :|..:.|:.:.......::|...||.:|    .|.....||      ..|...::|...:.|:|:
  Fly   326 NASYNDTQMNEEQDTTDTSSAHTDSTSY----QAGHIMAGS------VNGGGVNNFSNVLAAVSS 380

 Frog    68 SPDLQWLVQPTLISSVAPSQSRAHPYGSTPAYSRSSVMKGSAGRGQSLGRRGKMEQLSPEEEEKR 132
            |.           .|.:...|.|:. .:|||       :...||     |..:...::||||:||
  Fly   381 SR-----------GSASVGSSNANT-SNTPA-------RRGGGR-----RPNRSTNMTPEEEQKR 421

 Frog   133 KVRRERNKMAAAKCRNRRRELTDTLQAETDDLEDQKSALQAEIAGLLKEKEKLEFILAAHKPAC- 196
            .|||||||.|||:||.||.:.|:.|..|.:.||.:..:::.||..|...|.:||::||.|:..| 
  Fly   422 AVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQ 486

 Frog   197 KIPHDLDGAFQDLTSSLDLGLISETPCSS------------SSQEPVA---EPLFPIGLSQSSMP 246
            ||..|:.............||:|.....|            ||...:.   ..|...|.|.|.:.
  Fly   487 KIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLD 551

 Frog   247 EKENTQL-QVSMELKSEPLDDFLFNSS---HTGVTDAAR-------SVPDVDLTSSLYTSEWEPL 300
            .|....: .:.|.:|.||||..:.:.|   ..|...:.|       ::|.|.|::.|        
  Fly   552 LKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTIL-------- 608

 Frog   301 YSTLSADMEPLCTPVVTCTPTCTTYTTSFVFTYPESDHFPNCGAAHRRGSSSNEQSS--DSLNSP 363
             :...|....|.||:.:..|      ..|...:|.:.:          |||.|..:|  :::|||
  Fly   609 -TPTGASSGSLQTPITSTAP------GGFGSAFPVTSN----------GSSINNINSIGNNMNSP 656

 Frog   364 TLLA 367
            ||.|
  Fly   657 TLNA 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fosNP_001016200.1 bZIP_Fos 131..192 CDD:269869 29/60 (48%)
coiled coil 132..191 CDD:269869 27/58 (47%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/60 (48%)
coiled coil 421..480 CDD:269869 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10394
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002314
OrthoInspector 1 1.000 - - otm49511
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.