DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF43 and rnf13

DIOPT Version :9

Sequence 1:XP_011523257.1 Gene:RNF43 / 54894 HGNCID:18505 Length:869 Species:Homo sapiens
Sequence 2:NP_957338.1 Gene:rnf13 / 793981 ZFINID:ZDB-GENE-040426-772 Length:377 Species:Danio rerio


Alignment Length:276 Identity:71/276 - (25%)
Similarity:121/276 - (43%) Gaps:66/276 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    77 PAEGK---LMQSHPLYLCNASDD----DNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERG- 133
            |:||.   |:.:.|...|...:.    :||...||.:::        |...:...|...|.:.| 
Zfish    60 PSEGLKGFLIGARPENACVPIEPPPQRENLSSAFIVLIR--------RFDCNFDIKVLHAQKAGY 116

Human   134 ASAVLFDITED---RAAAEQLQQPLGLTWPVVLIWGNDAEKLME-FVYKNQKAHVRIELKEPPAW 194
            .:|::.::..|   ...:|.|.....:..|.|.|....|..|.| ::|: :..||.:       .
Zfish   117 KAAIVHNVDSDDLISMGSEDLDILKQIDIPSVFIGEEAANSLKEDYIYE-KGGHVIL-------M 173

Human   195 PDYDVWI------LMTVVGTIFVIILASVL------RIRCRPRHSRPDPLQQRTAWAISQLATRR 247
            ||:.:.:      .:.:||...::|:..::      |.|.|....|.|.|:        :|...:
Zfish   174 PDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRLRKDQLK--------KLPIHK 230

Human   248 YQASCRQARGEWPDSGSSCSSAPVCAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQ-HRTCPL 311
            ::      :|:         |..||||||:|:.||:.|||:.|.|.:|..||||||.: .:|||:
Zfish   231 FK------KGD---------SYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPV 280

Human   312 CMFNI--TEGDSFSQS 325
            |...:  ::|||.|.|
Zfish   281 CKQKVVPSDGDSESDS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF43XP_011523257.1 Peptidases_S8_S53 <87..186 CDD:299169 23/107 (21%)
zf-RING_2 270..312 CDD:290367 24/42 (57%)
rnf13NP_957338.1 PA_C_RZF_like 23..180 CDD:239038 29/135 (21%)
zf-RING_2 238..282 CDD:290367 24/43 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.