DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF43 and rnf130

DIOPT Version :9

Sequence 1:XP_011523257.1 Gene:RNF43 / 54894 HGNCID:18505 Length:869 Species:Homo sapiens
Sequence 2:XP_009289393.1 Gene:rnf130 / 553950 ZFINID:ZDB-GENE-050522-525 Length:428 Species:Danio rerio


Alignment Length:183 Identity:50/183 - (27%)
Similarity:78/183 - (42%) Gaps:57/183 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   162 VLIWGNDAEKLMEFVYKNQKAHVRIELKEPPAWPDYDVWILMTVVGT------------IFVIIL 214
            |:|..:..::::.|:.|||...|.:                  :||:            :||.|.
Zfish   164 VMITESFGKEILGFLEKNQTVLVSV------------------IVGSRGMPKNINRGSLVFVSIS 210

Human   215 ASVLRI------------RCRPRHSRPDPLQQR----TAWAISQLATRRYQASCRQARGEWPDSG 263
            ..||.|            :.|...:| |..|:|    ...|||:|.||..:...::..   ||..
Zfish   211 FIVLMIISSAWLIFYFIQKIRDTSAR-DRSQRRLGDAAKKAISKLTTRTVKRGDKETE---PDFN 271

Human   264 SSCSSAPVCAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQHRTCPLCMFNI 316
            .       ||:|:|.:.....:|::.|.|.||:.||||||::|.|||:|..||
Zfish   272 H-------CAVCIEGYQLNDVVRILPCKHVFHKMCVDPWLNEHCTCPMCKLNI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF43XP_011523257.1 Peptidases_S8_S53 <87..186 CDD:299169 7/23 (30%)
zf-RING_2 270..312 CDD:290367 19/41 (46%)
rnf130XP_009289393.1 PA_GRAIL_like 49..188 CDD:239037 7/23 (30%)
zf-RING_2 271..314 CDD:290367 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.