DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF43 and mura

DIOPT Version :9

Sequence 1:XP_011523257.1 Gene:RNF43 / 54894 HGNCID:18505 Length:869 Species:Homo sapiens
Sequence 2:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster


Alignment Length:47 Identity:23/47 - (48%)
Similarity:31/47 - (65%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   272 CAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQHRTCPLCMFNITE 318
            |.:|:.:|...|.|||:.|.||||..|||.||..:||||:|..|.::
  Fly  1077 CVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASD 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF43XP_011523257.1 Peptidases_S8_S53 <87..186 CDD:299169
zf-RING_2 270..312 CDD:290367 21/39 (54%)
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 21/40 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.