DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF43 and gol

DIOPT Version :9

Sequence 1:XP_011523257.1 Gene:RNF43 / 54894 HGNCID:18505 Length:869 Species:Homo sapiens
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:350 Identity:86/350 - (24%)
Similarity:137/350 - (39%) Gaps:85/350 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   125 KARMAGE-RGASAVLFDITEDRAAAEQLQQPLGLTW------PVVLIWGNDAEKLMEFVYKNQKA 182
            |.::.|: |..:||:        ..:.:.|.|.||.      .:.:|.|....:.:..:.:....
  Fly   180 KMQIKGKTRNIAAVI--------TYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVL 236

Human   183 HVRIELKEPPAWPDYDVWILMTVVGTIFVIILASVLRIRCRPRHSRPDPLQQRTAWAISQLATRR 247
            .|.|         .:.|.:::::|..||..|.        |.|:.:....|.|...::::.|..:
  Fly   237 FVSI---------SFIVLMIISLVWLIFYYIQ--------RFRYMQAKDQQSRNLCSVTKKAIMK 284

Human   248 YQASCRQARGEWPDSGSSCSSAPVCAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQHRTCPLC 312
            ......:...| .|..|.|     ||||:|.:.....:|::.|.||||:||:||||.:|||||:|
  Fly   285 IPTKTGKFSDE-KDLDSDC-----CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMC 343

Human   313 MFNITE--GDSFSQSLGPSRS---YQ-EPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPR 371
            ..::.:  |..|   ||...|   || :|.:.|.|:......|.        |..||..|...||
  Fly   344 KLDVLKFYGYVF---LGSEESILEYQPDPPQGLALVEARDESAD--------LNRSRDFVVDFPR 397

Human   372 PGPFLPSQEPGMGPRHHRFPRAAHPRAPG-------------------EQQRLAGAQHPYAQGWG 417
              .|:......:|.|...||.....|:..                   |||.|...::...|...
  Fly   398 --VFVLDSGCVVGAREMLFPCRIPERSQSSLSLRQARDWVSLMSNKLEEQQGLRSMRNDEMQQQL 460

Human   418 LSHLQSTSQHPAACPVPLRRARPPD 442
            ||..:| ::|        ||:|..|
  Fly   461 LSARES-ARH--------RRSRSAD 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF43XP_011523257.1 Peptidases_S8_S53 <87..186 CDD:299169 12/67 (18%)
zf-RING_2 270..312 CDD:290367 22/41 (54%)
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 9/44 (20%)
UPF0233 226..>258 CDD:299753 6/40 (15%)
zf-RING_2 301..344 CDD:290367 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.