DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF43 and rnf167

DIOPT Version :9

Sequence 1:XP_011523257.1 Gene:RNF43 / 54894 HGNCID:18505 Length:869 Species:Homo sapiens
Sequence 2:XP_005165694.2 Gene:rnf167 / 101055497 ZFINID:ZDB-GENE-110126-2 Length:401 Species:Danio rerio


Alignment Length:324 Identity:79/324 - (24%)
Similarity:128/324 - (39%) Gaps:76/324 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    80 GKLMQSHPLYLCNASD---------DDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGAS 135
            |.|:::.|...|...|         |.|....:|.:::        |...:...|...|.:.|.|
Zfish    59 GVLIEARPQNACTPIDPPPASPTPADPNSTTKYIVLIR--------RYDCNFDVKVYHAQQAGYS 115

Human   136 AVLFDIT----------EDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKE 190
            |.:....          .:...||::..|...|       ...|.:::..:...:.|:|  .||.
Zfish   116 AAIVHNMYSNSLLNMGYSNETIAEEISIPSVFT-------SFFASQMLHKIIPEKGAYV--VLKP 171

Human   191 PPAWPDYDVWILMTVVGTIFVIILASVLRIRC-----RPRHSRPDPLQQRTAWAISQLATRRYQA 250
            ..::|.....|..|.|..:.:|::..::.:||     |.|.:|....|      :.::...::. 
Zfish   172 EFSFPLSYYLIPFTGVVCMIIIVMVIIMIVRCVQHRKRLRKNRLSKEQ------LKKIPIHKFN- 229

Human   251 SCRQARGEWPDSGSSCSSAPVCAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQ-HRTCPLCMF 314
                 :|:         |..||||||:|:.||.:|||:.|.|.:|..||||||.| .:|||:|..
Zfish   230 -----KGD---------SYDVCAICLDEYEEGDKLRVLPCSHAYHSRCVDPWLTQTKKTCPVCKQ 280

Human   315 NIT-------EGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPS-RSAVARPP 370
            .:|       |.....:..||..:.:|..|...|...:||.     ||:....|| .|.||..|
Zfish   281 RVTRPNPEYSESSDSDEEAGPHDAEEEDERTPLLRPSNPGS-----PASSSPPPSYSSTVASEP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF43XP_011523257.1 Peptidases_S8_S53 <87..186 CDD:299169 19/117 (16%)
zf-RING_2 270..312 CDD:290367 25/42 (60%)
rnf167XP_005165694.2 PA_C_RZF_like 14..177 CDD:239038 23/134 (17%)
RING-H2_RNF167 235..280 CDD:319711 26/44 (59%)
RING-H2 finger (C3H2C3-type) 237..278 CDD:319711 24/40 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.