DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rlim and gol

DIOPT Version :9

Sequence 1:NP_001016091.1 Gene:rlim / 548845 XenbaseID:XB-GENE-492020 Length:639 Species:Xenopus tropicalis
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:158 Identity:49/158 - (31%)
Similarity:75/158 - (47%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


 Frog   512 EEGSNVSTSSARREGRNSRGGVTFEESGSLPFLSLA-----------------QFFLLNEDDDDQ 559
            ::|.||:.|..  |||.....::.....|:.|:|::                 |.|...:..|.|
  Fly   208 DKGYNVTISII--EGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQRFRYMQAKDQQ 270

 Frog   560 PRGL---TKEQIDNLSTR--NFGENDALKT--CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLS 617
            .|.|   ||:.|..:.|:  .|.:...|.:  |::||..|...:.:|.|||.||:|.:|||.||.
  Fly   271 SRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLI 335

 Frog   618 ENSTCPICRRAVL------VAGNRESIV 639
            |:.|||:|:..||      ..|:.|||:
  Fly   336 EHRTCPMCKLDVLKFYGYVFLGSEESIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlimNP_001016091.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..403
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..534 7/21 (33%)
zf-RING_2 584..626 CDD:290367 20/43 (47%)
PDZ-binding. /evidence=ECO:0000255 636..639 2/2 (100%)
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 3/8 (38%)
UPF0233 226..>258 CDD:299753 3/31 (10%)
zf-RING_2 301..344 CDD:290367 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.