DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rlim and meu34

DIOPT Version :9

Sequence 1:NP_001016091.1 Gene:rlim / 548845 XenbaseID:XB-GENE-492020 Length:639 Species:Xenopus tropicalis
Sequence 2:NP_593329.1 Gene:meu34 / 2543036 PomBaseID:SPAC3A12.03c Length:309 Species:Schizosaccharomyces pombe


Alignment Length:119 Identity:31/119 - (26%)
Similarity:51/119 - (42%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


 Frog   510 ESEEGSNVSTSSARREGRNSRGGVTFEESGSLPFLSLAQFFLLNEDDDDQPRG--LTKEQIDNLS 572
            :.|..|.:.|...||.   :.|..:|.|..|    :|:..:..:..|.|....  |.:::.|   
pombe   149 QGETPSVIITYDVRRP---NLGSTSFVEMSS----ALSNIYNTDASDGDSSDDSCLLEDEED--- 203

 Frog   573 TRNFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSE-NSTCPIC 625
                       .|.:|..:|...:.||.|||.|.:|..|||.|::. .::||:|
pombe   204 -----------FCIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMKASCPLC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlimNP_001016091.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..403
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..534 6/23 (26%)
zf-RING_2 584..626 CDD:290367 17/43 (40%)
PDZ-binding. /evidence=ECO:0000255 636..639
meu34NP_593329.1 RING 205..249 CDD:238093 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3410
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.