Sequence 1: | NP_001016091.1 | Gene: | rlim / 548845 | XenbaseID: | XB-GENE-492020 | Length: | 639 | Species: | Xenopus tropicalis |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_595266.2 | Gene: | dsc1 / 2541251 | PomBaseID: | SPBC947.10 | Length: | 695 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 340 | Identity: | 59/340 - (17%) |
---|---|---|---|
Similarity: | 97/340 - (28%) | Gaps: | 140/340 - (41%) |
- Green bases have known domain annotations that are detailed below.
Frog 415 RAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFMYNDNDTDPNNPTPVSP 479
Frog 480 PAAVP------------GEAQNLVSPEPPA--------PIVEPP----EPVAPVESEE------- 513
Frog 514 -----------------------------GSNVSTSSA---------RREGRNSRGGVTFEESGS 540
Frog 541 L--PFLSLAQFFLLNEDDDDQPRGLTKEQI-------------------DNLSTRNF-------- 576
Frog 577 ---------GENDALK-------TCSVC---ITEYTEGNKLRK-----------LPCSHEYHVHC 611
Frog 612 IDRWLSENSTCPICR 626 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rlim | NP_001016091.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 67..403 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 467..534 | 19/135 (14%) | |||
zf-RING_2 | 584..626 | CDD:290367 | 15/55 (27%) | ||
PDZ-binding. /evidence=ECO:0000255 | 636..639 | ||||
dsc1 | NP_595266.2 | zf-RING_2 | 632..689 | CDD:290367 | 15/56 (27%) |
zf-rbx1 | <633..689 | CDD:289448 | 15/55 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |