DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rlim and sel-11

DIOPT Version :9

Sequence 1:NP_001016091.1 Gene:rlim / 548845 XenbaseID:XB-GENE-492020 Length:639 Species:Xenopus tropicalis
Sequence 2:NP_505969.1 Gene:sel-11 / 179612 WormBaseID:WBGene00004768 Length:610 Species:Caenorhabditis elegans


Alignment Length:103 Identity:29/103 - (28%)
Similarity:40/103 - (38%) Gaps:25/103 - (24%)


- Green bases have known domain annotations that are detailed below.


 Frog   540 SLPFLSLAQFFLLNEDDDDQPRGLTKEQIDNL----------------STRNFGENDALKTCSVC 588
            :.|..|:..|:       ...|.|.|..:|.:                |..:....||  ||.:|
 Worm   240 TFPLFSVRPFY-------QSVRALHKAFLDVILSRRAINAMNSQFPVVSAEDLAAMDA--TCIIC 295

 Frog   589 ITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICR 626
            ..|.|.....::|||||.:|.||:..|.....|||.||
 Worm   296 REEMTVDASPKRLPCSHVFHAHCLRSWFQRQQTCPTCR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlimNP_001016091.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..403
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..534
zf-RING_2 584..626 CDD:290367 17/41 (41%)
PDZ-binding. /evidence=ECO:0000255 636..639
sel-11NP_505969.1 HRD1 51..>333 CDD:227568 27/101 (27%)
zf-RING_2 291..333 CDD:290367 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.