Sequence 1: | NP_001016091.1 | Gene: | rlim / 548845 | XenbaseID: | XB-GENE-492020 | Length: | 639 | Species: | Xenopus tropicalis |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499473.2 | Gene: | plr-1 / 176575 | WormBaseID: | WBGene00023404 | Length: | 487 | Species: | Caenorhabditis elegans |
Alignment Length: | 317 | Identity: | 66/317 - (20%) |
---|---|---|---|
Similarity: | 95/317 - (29%) | Gaps: | 116/317 - (36%) |
- Green bases have known domain annotations that are detailed below.
Frog 404 GGFRRTFSRSERAGVRTYVSTIRI--PIRRILNTGLSETTSVAIQTMLRQIMTG---------FG 457
Frog 458 ELSYFMYNDNDTDPNNPTPVSPPAAVPGEAQNLVSPEPPAPIVEPPEPVAPVESEEGSNVSTSSA 522
Frog 523 RREGRNS--RGGVT-----FEESGSLPFLSLAQF---------------------FLLNEDDDDQ 559
Frog 560 P--------RGLTKEQIDNLSTRNF---------------------------------------- 576
Frog 577 -------GENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICR 626 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rlim | NP_001016091.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 67..403 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 467..534 | 14/68 (21%) | |||
zf-RING_2 | 584..626 | CDD:290367 | 19/41 (46%) | ||
PDZ-binding. /evidence=ECO:0000255 | 636..639 | ||||
plr-1 | NP_499473.2 | zf-rbx1 | 305..358 | CDD:289448 | 20/52 (38%) |
zf-RING_2 | 317..357 | CDD:290367 | 19/39 (49%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1487241at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |