DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB12 and DnaJ-1

DIOPT Version :9

Sequence 1:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:149 Identity:58/149 - (38%)
Similarity:72/149 - (48%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   109 KDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQF 173
            ||:|:|||:.|.|||:::|||||:||||:|||||.:|.|.|.||.|..||.|||:.:||..:|.:
  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67

Human   174 GDD---KSQAARHGHG---------HGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMR 226
            |:|   ..|....|.|         |||....|.......|.|..||.||               
  Fly    68 GEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGG--------------- 117

Human   227 YTYQQRQDRRDNQGDGGLG 245
                      ||...||.|
  Fly   118 ----------DNMFSGGQG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ 110..>236 CDD:333066 52/137 (38%)
DUF1977 268..368 CDD:312722
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 58/149 (39%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 157..320 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.