DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB12 and DnaJ-H

DIOPT Version :9

Sequence 1:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:154 Identity:51/154 - (33%)
Similarity:71/154 - (46%) Gaps:40/154 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   112 YEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDD 176
            |::|.|:..|:||::||.||:||.:||||||  |.|.:.||.|..||.|||:||||:.||::|..
  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69

Human   177 KSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNV---------------------HVY 220
            ..|....|.          :|.|.      ||...||...|                     .:|
  Fly    70 GLQEGAEGF----------SDASE------FFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIY 118

Human   221 SNG-RMRYTYQQRQDRRDNQGDGG 243
            ..| :.:..|.:::......||||
  Fly   119 VGGMKKKVEYNRQKLCSKCNGDGG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ 110..>236 CDD:333066 47/145 (32%)
DUF1977 268..368 CDD:312722
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 51/154 (33%)
DnaJ 5..64 CDD:278647 32/58 (55%)
DnaJ_C 106..329 CDD:199909 7/37 (19%)
DnaJ_zf 134..197 CDD:199908 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.