DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB12 and shv

DIOPT Version :10

Sequence 1:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:106 Identity:47/106 - (44%)
Similarity:62/106 - (58%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   109 KDYYEILGVSRGASDEDLKKAYRRLALKFHPDKN-HAPGATEAFKAIGTAYAVLSNPEKRKQYDQ 172
            :|:|:||.|.:.|:..::||||||||.:.||||| ..|.|:..|:.:|.||.|||||:|||.||:
  Fly    24 RDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYDR 88

Human   173 FGDD---KSQAARHGHGHGDFHRGFEADISPEDLFNMFFGG 210
            .|::   |.....||   ||....|..|      |...|||
  Fly    89 CGEECLKKEGMMDHG---GDPFSSFFGD------FGFHFGG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ_bact 110..>236 CDD:274090 47/105 (45%)
DUF1977 268..366 CDD:462754
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 47/105 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.