DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPIA and CG30350

DIOPT Version :10

Sequence 1:NP_066953.1 Gene:PPIA / 5478 HGNCID:9253 Length:165 Species:Homo sapiens
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:185 Identity:38/185 - (20%)
Similarity:70/185 - (37%) Gaps:46/185 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVNPTVFFDIAV-DGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQG 64
            :..|.::||:.: |..||||...:|:.:..|...                    .::|...||  
  Fly   210 LFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVV--------------------LQLIKSCMC-- 252

Human    65 GDFTRHNG-----------------TGGKSIYGEKFEDENFILKHTGPG-ILSMANAGPN--TNG 109
               .:|:.                 ....|:..:..|.:..::.|.... :||.:.|...  |:.
  Fly   253 ---NQHSKFMVKRLFPNLWLETDLMLSSDSLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHH 314

Human   110 SQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164
            ..|.|.......::|..|.||::.:|..|.|.::.:|::|||.|:.:....||.|
  Fly   315 LSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCGLL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPIANP_066953.1 cyclophilin_ABH_like 4..162 CDD:238907 35/178 (20%)
CG30350NP_724715.1 Hmw_CFAP97 61..155 CDD:464014
Pro_isomerase 227..367 CDD:459694 30/164 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.