DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIRAS2 and diras1b

DIOPT Version :9

Sequence 1:NP_060064.2 Gene:DIRAS2 / 54769 HGNCID:19323 Length:199 Species:Homo sapiens
Sequence 2:NP_001119893.1 Gene:diras1b / 565395 ZFINID:ZDB-GENE-070912-620 Length:198 Species:Danio rerio


Alignment Length:199 Identity:163/199 - (81%)
Similarity:183/199 - (91%) Gaps:1/199 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGS 65
            ||||||||||.||||||||||||||||||||||::||||||||||||||||||:|||||||||||
Zfish     1 MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTVEDTYRQVISCDKSVCTLQITDTTGS 65

Human    66 HQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSRE 130
            |||||||||||||||||||||||||:||||||||||:||..|||:||:|||||||||.||: .||
Zfish    66 HQFPAMQRLSISKGHAFILVYSITSKQSLEELKPIYQQILAIKGNVENIPIMLVGNKSDET-QRE 129

Human   131 VQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGK 195
            |::.:.||.::||||||||||||.||||.|||||||||||:|::||.||||:|.:|.|.:|||||
Zfish   130 VKTEDGEAQSKTWKCAFMETSAKTNHNVTELFQELLNLEKKRSMSLNIDGKRSGKQSRADKLKGK 194

Human   196 CVIM 199
            |.:|
Zfish   195 CSVM 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIRAS2NP_060064.2 ARHI_like 7..170 CDD:206711 138/162 (85%)
Effector region. /evidence=ECO:0000255 36..44 7/7 (100%)
diras1bNP_001119893.1 P-loop_NTPase 7..169 CDD:304359 138/162 (85%)
small_GTPase 17..171 CDD:197466 131/154 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - otm27222
orthoMCL 1 0.900 - - OOG6_106316
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5443
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.