Sequence 1: | NP_060064.2 | Gene: | DIRAS2 / 54769 | HGNCID: | 19323 | Length: | 199 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_730950.2 | Gene: | Rheb / 117332 | FlyBaseID: | FBgn0041191 | Length: | 182 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 70/201 - (34%) |
---|---|---|---|
Similarity: | 115/201 - (57%) | Gaps: | 23/201 - (11%) |
- Green bases have known domain annotations that are detailed below.
Human 1 MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGS 65
Human 66 HQ---FPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESP 127
Human 128 SREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKL 192
Human 193 KGKCVI 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIRAS2 | NP_060064.2 | ARHI_like | 7..170 | CDD:206711 | 64/165 (39%) |
Effector region. /evidence=ECO:0000255 | 36..44 | 4/7 (57%) | |||
Rheb | NP_730950.2 | RheB | 5..182 | CDD:206709 | 68/195 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0395 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |