DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIRAS2 and Rheb

DIOPT Version :9

Sequence 1:NP_060064.2 Gene:DIRAS2 / 54769 HGNCID:19323 Length:199 Species:Homo sapiens
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:201 Identity:70/201 - (34%)
Similarity:115/201 - (57%) Gaps:23/201 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGS 65
            ||  :.:..:|:.|...||||||.::||:|.|.:||.||:|:|:.::.........:::.||.|.
  Fly     1 MP--TKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQ 63

Human    66 HQ---FPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESP 127
            .:   ||....:..   |.::|||||||::|.|.:|.|||::.::.|. :.:|::|||||.|...
  Fly    64 DEYSIFPVQYSMDY---HGYVLVYSITSQKSFEVVKIIYEKLLDVMGK-KYVPVVLVGNKIDLHQ 124

Human   128 SREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKL 192
            .|.|.:.|.:.||.:|:.||:|||||.|.:|.::|.:||.|         |:.:....|:     
  Fly   125 ERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLIL---------IENENGNPQE----- 175

Human   193 KGKCVI 198
            |..|::
  Fly   176 KSGCLV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIRAS2NP_060064.2 ARHI_like 7..170 CDD:206711 64/165 (39%)
Effector region. /evidence=ECO:0000255 36..44 4/7 (57%)
RhebNP_730950.2 RheB 5..182 CDD:206709 68/195 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.