DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FEV and pnt

DIOPT Version :10

Sequence 1:NP_059991.1 Gene:FEV / 54738 HGNCID:18562 Length:238 Species:Homo sapiens
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:91 Identity:64/91 - (70%)
Similarity:69/91 - (75%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    43 GSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRY 107
            |||.|||||||||||.|:.....|:|.|...|||||||||||||||.||:||.|||:||||.|||
  Fly   606 GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRY 670

Human   108 YYDKNIMSKVHGKRYAYRF--DFQGL 131
            ||||||:.|..||||.|||  |.|.|
  Fly   671 YYDKNIIHKTAGKRYVYRFVCDLQNL 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FEVNP_059991.1 ETS 46..131 CDD:197710 60/86 (70%)
May mediate active transcriptional repression 129..238 2/3 (67%)
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 58/83 (70%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.