| Sequence 1: | NP_059980.2 | Gene: | TMED9 / 54732 | HGNCID: | 24878 | Length: | 235 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572754.1 | Gene: | p24-1 / 32140 | FlyBaseID: | FBgn0030341 | Length: | 210 | Species: | Drosophila melanogaster |
| Alignment Length: | 35 | Identity: | 13/35 - (37%) |
|---|---|---|---|
| Similarity: | 14/35 - (40%) | Gaps: | 2/35 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Human 545 RHTSQGMGIPVLPYPEPAEPGGHGGPSTFGLDTRW 579 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TMED9 | NP_059980.2 | EMP24_GP25L | 37..230 | CDD:426051 | |
| Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 | 121..160 | ||||
| COPI vesicle coat-binding. /evidence=ECO:0000255 | 228..235 | ||||
| COPII vesicle coat-binding. /evidence=ECO:0000255 | 228..229 | ||||
| p24-1 | NP_572754.1 | EMP24_GP25L | 21..197 | CDD:426051 | 13/35 (37%) |
| Blue background indicates that the domain is not in the aligned region. | |||||