DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMED9 and p24-1

DIOPT Version :10

Sequence 1:NP_059980.2 Gene:TMED9 / 54732 HGNCID:24878 Length:235 Species:Homo sapiens
Sequence 2:NP_572754.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster


Alignment Length:35 Identity:13/35 - (37%)
Similarity:14/35 - (40%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   545 RHTSQGMGIPVLPYPEPAEPGGHGGPSTFGLDTRW 579
            ||:|...  |.|..||.....|.|......|||.|
  Fly   154 RHSSNNN--PKLHMPESLTLTGSGLSMKTSLDTFW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMED9NP_059980.2 EMP24_GP25L 37..230 CDD:426051
Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 121..160
COPI vesicle coat-binding. /evidence=ECO:0000255 228..235
COPII vesicle coat-binding. /evidence=ECO:0000255 228..229
p24-1NP_572754.1 EMP24_GP25L 21..197 CDD:426051 13/35 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.