DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMED9 and p24-2

DIOPT Version :10

Sequence 1:NP_059980.2 Gene:TMED9 / 54732 HGNCID:24878 Length:235 Species:Homo sapiens
Sequence 2:NP_788617.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster


Alignment Length:206 Identity:128/206 - (62%)
Similarity:163/206 - (79%) Gaps:5/206 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    24 TLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVE 88
            :|.|:|.:......|||||.:||:||||||:||||.||.||:.:|||.:...:.|::||:||.||
  Fly     7 SLALILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVE 71

Human    89 VKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYA 153
            |:|.:||::|:|.|.|:||.:|||||||||.||:.||||.:  |:|..|||||||||||||.|||
  Fly    72 VRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYA 134

Human   154 EIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIG 218
            .:|.|:||:|||||:|||::|||||.|||||||:||||||.||||||.||||||:.||::||.:|
  Fly   135 HVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMG 199

Human   219 VWQMRHLKSFF 229
            .|   ||.:.|
  Fly   200 FW---HLFNLF 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TMED9NP_059980.2 EMP24_GP25L 37..230 CDD:426051 125/193 (65%)
Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 121..160 25/38 (66%)
COPI vesicle coat-binding. /evidence=ECO:0000255 228..235 1/2 (50%)