| Sequence 1: | NP_536681.2 | Gene: | Fezf2 / 54713 | MGIID: | 1859823 | Length: | 455 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097306.2 | Gene: | cg / 36571 | FlyBaseID: | FBgn0000289 | Length: | 837 | Species: | Drosophila melanogaster |
| Alignment Length: | 239 | Identity: | 80/239 - (33%) |
|---|---|---|---|
| Similarity: | 116/239 - (48%) | Gaps: | 27/239 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 239 QVLKENSALTAERGGVKSHSKLPGGSTDSKPKN--------------------FTCEVCGKVFNA 283
Mouse 284 HYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIR 348
Mouse 349 IHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFT 413
Mouse 414 CATCGKGFCRNFDLKKHVRKLHDSVGPTATPSAKDL--ARTVQS 455 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fezf2 | NP_536681.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
| Engrailed homology 1 repressor | 27..42 | ||||
| C2H2 Zn finger | 274..294 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | <284..>390 | CDD:227381 | 42/105 (40%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 317..339 | CDD:404364 | 8/21 (38%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
| SFP1 | <380..436 | CDD:227516 | 22/55 (40%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 414..432 | CDD:275368 | 9/17 (53%) | ||
| cg | NP_001097306.2 | COG5048 | 287..>371 | CDD:227381 | 32/83 (39%) |
| C2H2 Zn finger | 294..314 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 306..331 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 322..342 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 350..370 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 362..385 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 378..398 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 390..415 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 406..426 | CDD:275368 | 6/19 (32%) | ||
| SIR2 | <425..>465 | CDD:294129 | 15/40 (38%) | ||
| C2H2 Zn finger | 434..454 | CDD:275368 | 10/20 (50%) | ||
| C2H2 Zn finger | 461..482 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 490..509 | CDD:275368 | |||
| lambda-1 | 491..>603 | CDD:212564 | |||
| C2H2 Zn finger | 575..595 | CDD:275368 | |||
| C2H2 Zn finger | 720..740 | CDD:275368 | |||
| C2H2 Zn finger | 752..771 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24388 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||