| Sequence 1: | NP_536681.2 | Gene: | Fezf2 / 54713 | MGIID: | 1859823 | Length: | 455 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608809.1 | Gene: | CG3407 / 33606 | FlyBaseID: | FBgn0031573 | Length: | 714 | Species: | Drosophila melanogaster |
| Alignment Length: | 353 | Identity: | 89/353 - (25%) |
|---|---|---|---|
| Similarity: | 131/353 - (37%) | Gaps: | 93/353 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 168 NYLDSTAYPPSELLGGHLFPSGLLNAQAPTSLAAHPKLFLLENAKLASLAADKFPHP-------- 224
Mouse 225 ---------ASYPHKERL--------HAPLEQVLKENSALTAERGGVKSHSKL----PGGSTDSK 268
Mouse 269 PKN---------------FTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRH 318
Mouse 319 KIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPF--------------------------- 356
Mouse 357 --VCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGK 419
Mouse 420 GFCRNFDLKKHVRKLHDSVGPTATPSAK 447 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fezf2 | NP_536681.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
| Engrailed homology 1 repressor | 27..42 | ||||
| C2H2 Zn finger | 274..294 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | <284..>390 | CDD:227381 | 39/134 (29%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 317..339 | CDD:404364 | 9/21 (43%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 8/19 (42%) | ||
| SFP1 | <380..436 | CDD:227516 | 20/55 (36%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 414..432 | CDD:275368 | 8/17 (47%) | ||
| CG3407 | NP_608809.1 | COG5048 | <494..656 | CDD:227381 | 51/162 (31%) |
| C2H2 Zn finger | 497..517 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 509..534 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 525..545 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 537..562 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 555..574 | CDD:275371 | 0/18 (0%) | ||
| zf-C2H2 | 580..602 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 582..602 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 594..617 | CDD:290200 | 8/22 (36%) | ||
| C2H2 Zn finger | 610..630 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 622..645 | CDD:290200 | 7/22 (32%) | ||
| zf-C2H2 | 636..658 | CDD:278523 | 9/22 (41%) | ||
| C2H2 Zn finger | 638..658 | CDD:275368 | 9/20 (45%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||