DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNHIT6 and CG1463

DIOPT Version :10

Sequence 1:NP_060423.3 Gene:ZNHIT6 / 54680 HGNCID:26089 Length:470 Species:Homo sapiens
Sequence 2:NP_572813.2 Gene:CG1463 / 32211 FlyBaseID:FBgn0030406 Length:336 Species:Drosophila melanogaster


Alignment Length:272 Identity:80/272 - (29%)
Similarity:140/272 - (51%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   193 IVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGV 257
            :.|:|..|           .|.:.:..||.|..:||.|.||:|...:||||||:.||.||.|:|.
  Fly     1 MADETSTK-----------TRTMRLGMCEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCDGQ 54

Human   258 RDKTAYISIQQFTEMNLLSDYRFLEDVARTADHISRDAFLKR--------PISNKYMYFMKNRAR 314
            ||:|.::.:.:.|....:|||.|||:..|.|::...|. .||        |::   .:.|:..|:
  Fly    55 RDRTKFVPLSEMTSREFMSDYCFLEECTRYAENRKSDP-CKRFTHDQRNLPVT---QHRMRMAAK 115

Human   315 RQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVKLQF---------PQSQAEYIEKRVPDDKTI 370
            ::.|||:|....|::.|||:|:.:.|..:|.|.::..|         |::...:::|...::.|:
  Fly   116 KRNINLRLQLENFSRHKENTTYLNWKLGRFHWRIEWLFANIPYEASLPRNVTRFVDKECNEELTL 180

Human   371 NEILKPYIDPEKSDPVIRQRLKAYIRSQTG----VQILMKIEYMQQNLVRYYELDPYKSLLDNLR 431
            .:::..|:|....  ..|::.|.....||.    :...::.|.::::..|.|.||..|:|.:||.
  Fly   181 PDLVAKYVDLRHE--TAREQRKLLANHQTAGIGQLSFWLRAEGVRRSSTRCYLLDSTKTLAENLV 243

Human   432 NKVIIEYPTLHV 443
            .|.|:|:||:.|
  Fly   244 GKTIVEFPTILV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNHIT6NP_060423.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
zf-HIT_BCD1 218..257 CDD:467795 20/38 (53%)
CG1463NP_572813.2 zf-HIT_BCD1 15..54 CDD:467795 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.