DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPARG and Hr96

DIOPT Version :9

Sequence 1:NP_056953.2 Gene:PPARG / 5468 HGNCID:9236 Length:505 Species:Homo sapiens
Sequence 2:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster


Alignment Length:380 Identity:99/380 - (26%)
Similarity:143/380 - (37%) Gaps:104/380 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   130 PSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRC--DLNCRIHKKSRNKCQY 192
            |.|      |.||||||.|:::....||.||.||||....|..: .|  :.||.|...:|..||.
  Fly     4 PKN------CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQF-TCPFNQNCDITVVTRRFCQK 61

Human   193 CRFQKCLAVGMSHNAIRFGRMPQAEKEKL--------------LAEISSD-IDQLNPESADLRAL 242
            ||.:|||.:||....|      .:|::||              |.|..:| .|....|..|.:|.
  Fly    62 CRLRKCLDIGMKSENI------MSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAP 120

Human   243 A-------KHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI---------- 290
            |       .| |.....|.....|.:.|.........||..  .:|.|.|..:||          
  Fly   121 ADSSSSNLDH-YSGSQDSQSCGSADSGANGCSGRQASSPGT--QVNPLQMTAEKIVDQIVSDPDR 182

Human   291 KFKHITPLQEQSKEVAIRIFQ---GCQFRSVEAVQEITEY----AKSIPGFVNLDLNDQVTLLKY 348
            ..:.|..|....|| ||.:.:   ..|..::..|..:.:|    .|.|..|:|...|......|:
  Fly   183 ASQAINRLMRTQKE-AISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNALTVFTKF 246

Human   349 ------GVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSL-RKPFGDFMEPKFEFAVKFNALE 406
                  || |||    :.:::....::         ||:::| ..|     |...:...||    
  Fly   247 MSSPTDGV-EII----SKIVDSPADVV---------EFMQNLMHSP-----EDAIDIMNKF---- 288

Human   407 LDDSDLAIFIAVIILSG----------DRPGLLN----VKPIEDIQ--DNLLQAL 445
            ::....|:.|...||||          ||..||:    |||....:  |.::|::
  Fly   289 MNTPAEALRILNRILSGGGANAAQQTADRKPLLDKEPAVKPAAPAERADTVIQSM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPARGNP_056953.2 PPARgamma_N 31..108 CDD:289354
NR_DBD_Ppar 138..221 CDD:143523 33/84 (39%)
Interaction with FAM120B. /evidence=ECO:0000250 205..280 19/96 (20%)
NR_LBD_PPAR 237..504 CDD:132730 57/256 (22%)
Rosiglitazon binding, agonist. /evidence=ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG 314..317 1/2 (50%)
9aaTAD. /evidence=ECO:0000269|PubMed:30468856 495..503
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 36/105 (34%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.