DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRN3 and Fili

DIOPT Version :9

Sequence 1:NP_001093128.1 Gene:LRRN3 / 54674 HGNCID:17200 Length:708 Species:Homo sapiens
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:398 Identity:112/398 - (28%)
Similarity:188/398 - (47%) Gaps:38/398 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     8 IHVLLGLAITTLVQAVDKKVDCPRLCTCEIRPWFTPRSIYMEA-STVDCNDLGLLTFPARLPANT 71
            |.|||.|.:|.::...:....||..|.|          :..|| |...|.|..|...|.:|...|
  Fly    21 IPVLLLLLLTLVILPPETTAFCPSKCQC----------LGGEANSRALCVDAALEDVPIQLNPET 75

Human    72 QILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCL 136
            :.:.|..|.|..:|:|..|.:.|..||||||.:.::.:.|.:...:|.::.|..|.::.|.:...
  Fly    76 KYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAF 140

Human   137 SELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPII 201
            ..|:||..|.::.|.:.|:.|.|...|.:|:.|.|.:|.:..:....|..:..||:|:...|.::
  Fly   141 KGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLL 205

Human   202 RIKDMN------------------------FKPLINLRSLVIAGINLTEIPDNALVGLENLESIS 242
            .:...|                        |:.|..|.:|.:.|..::|:..:|..||.:|:.:.
  Fly   206 DVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLD 270

Human   243 FYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISIDSLA-VD 306
            ..||.|..||...|.|:.||.:|:|..|..:::....|.|:.||:||.::.:..|..|||.| ||
  Fly   271 LSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVD 335

Human   307 NLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIR 371
            | ..|:.:...|||:||.|....|...|.:..:.:.||:|..||.... .:..|:::.:..||::
  Fly   336 N-THLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQ 398

Human   372 CDCVIRWM 379
            |:|.:.|:
  Fly   399 CNCSLLWL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRN3NP_001093128.1 LRRNT 28..72 CDD:214470 12/44 (27%)
LRR 1 70..91 6/20 (30%)
leucine-rich repeat 72..93 CDD:275380 6/20 (30%)
LRR <75..355 CDD:227223 87/304 (29%)
LRR 2 93..114 8/20 (40%)
leucine-rich repeat 94..117 CDD:275380 8/22 (36%)
LRR 3 117..138 4/20 (20%)
leucine-rich repeat 118..141 CDD:275380 5/22 (23%)
LRR 4 141..162 7/20 (35%)
leucine-rich repeat 142..165 CDD:275380 7/22 (32%)
LRR 5 165..186 5/20 (25%)
leucine-rich repeat 166..189 CDD:275380 5/22 (23%)
LRR 6 189..210 6/44 (14%)
leucine-rich repeat 190..213 CDD:275380 7/46 (15%)
LRR 7 213..234 5/20 (25%)
leucine-rich repeat 214..237 CDD:275380 7/22 (32%)
LRR 8 237..258 7/20 (35%)
leucine-rich repeat 238..261 CDD:275380 8/22 (36%)
LRR 9 261..282 6/20 (30%)
leucine-rich repeat 262..285 CDD:275380 6/22 (27%)
LRR 10 285..304 8/18 (44%)
leucine-rich repeat 286..310 CDD:275380 11/24 (46%)
LRR 11 310..332 8/21 (38%)
leucine-rich repeat 311..333 CDD:275380 8/21 (38%)
LRR 12 335..358 5/22 (23%)
leucine-rich repeat 336..359 CDD:275380 5/22 (23%)
PCC 341..>442 CDD:188093 11/39 (28%)
Ig 437..513 CDD:325142
fn3 526..593 CDD:306538
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 7/21 (33%)
leucine-rich repeat 98..121 CDD:275380 8/22 (36%)
LRR_8 120..180 CDD:404697 17/59 (29%)
leucine-rich repeat 122..145 CDD:275380 5/22 (23%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
LRR <161..>354 CDD:227223 55/193 (28%)
leucine-rich repeat 170..193 CDD:275380 5/22 (23%)
leucine-rich repeat 194..217 CDD:275380 5/22 (23%)
leucine-rich repeat 218..265 CDD:275380 9/46 (20%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..338 CDD:275380 11/24 (46%)
LRR_8 337..397 CDD:404697 16/60 (27%)
leucine-rich repeat 339..360 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8524
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.