DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POU5F1B and nub

DIOPT Version :9

Sequence 1:NP_001153014.1 Gene:POU5F1B / 5462 HGNCID:9223 Length:359 Species:Homo sapiens
Sequence 2:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster


Alignment Length:220 Identity:103/220 - (46%)
Similarity:132/220 - (60%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    78 PQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIKAL 142
            |.....|...|.|..|.|.|    |.:.:....:|:|.||...|.  .:...|.:||::.|:   
  Fly   731 PSSAASLKLSGMLTPSTPTS----GTQMSQGTTTPQPKTVASAAA--ARAAGEPSPEETTDL--- 786

Human   143 QKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKW 207
             :|||||||..||:||.||:||.||||.:|.|:|..|||.||.|||||.|||||||||:||||||
  Fly   787 -EELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKW 850

Human   208 VEEADNN----------ENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTL-QISH 261
            :::||..          ..||.......::..|::||||||..:||.||..||...|||. :|:.
  Fly   851 LDDADRTIQATGGVFDPAALQATVSTPEIIGRRRKKRTSIETTIRGALEKAFLANQKPTSEEITQ 915

Human   262 IAQQLGLEKDVVRVWFCNRRQKGKR 286
            :|.:|.:||:||||||||||||.||
  Fly   916 LADRLSMEKEVVRVWFCNRRQKEKR 940

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POU5F1BNP_001153014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..116 8/28 (29%)
POU 138..212 CDD:197673 48/73 (66%)
Homeobox 233..285 CDD:278475 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..322 103/220 (47%)
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 44/63 (70%)
Homeobox 886..939 CDD:278475 32/52 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.